Pay in 4 interest-free payments of $29.50 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
Activator 1 subunit 3
SYLQSFLETAHHALHHLPRPAQKHFPESLFISI
Cross Reactivity: This kit recognizes Rat PLAUR/uPAR in samples
It may also negatively regulate cell proliferation through interaction with the C-terminal region of the adenomatosis polyposis coli tumor suppressor protein
Recombinant Mouse IL1A/IL-1A/IL-1F1 protein (His tag) - PDEM100069 Stem Cells Activator 1 subunit 3Recombinant Mouse IL1A IL 1A IL 1F1 protein (His tag) Size: 100g Catalogue Numbers: PDEM100069 100 Citations, Manuals and MSDS Available upon request. Abbreviation: IL1A; IL 1A; IL 1F1 Target Synonym: Interleukin 1 Alpha; IL 1 Alpha; Il1a UNIProt ID: P01582 Research Areas: Immunology; Metabolism; Neuroscience Target Species: Mouse Expression Host: E. coli Fusion Tag: C His Accession: P01582 Background: Mouse Interleukin 1 (IL 1) designates two